Back to home

Peptide Catalog

Browse our full range of research peptides, blends, and laboratory supplies with current pricing and dosage details.

≥ 99%

Tirzepatide 25mg + Retatrutide 20mg blend

Triple GIP/GLP-1/Glucagon receptor agonism blend research

$140.00 / 2mL vial

≥ 99%

C₁₀H₁₆N₂O₃S (Vitamin B7)

Metabolic & enzyme-cofactor research

Coming Soon

≥ 99%

GEPPPGKPADDAGLV

Gastrointestinal & healing studies

$39.00 / 2mL vial

≥ 99%

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Leu-Leu-Ala-Gln-Lys-(DAC)

Extended half-life GH-releasing research

$78.00 / 2mL vial

≥ 99%

C₅H₁₄NO (Choline)

Lipotropic & neurotransmitter-precursor research

$14.00 / 2mL vial

≥ 99%

C₆₃H₈₈CoN₁₄O₁₄P (Cyanocobalamin)

Energy-metabolism & erythropoiesis research

$20.00 / 10mL vial

≥ 99%

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Leu-Leu-Ala-Gln-Lys

Short-acting GH secretagogue research

$46.00 / 2mL vial

≥ 99%

CJC-1295 w/o DAC 9mg + Ipamorelin 15mg blend

Dual GH-secretagogue blend research

$49.00 / 6mL vial

≥ 99%

Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu

Sleep-regulation & neuroendocrine research

$55.00 / 2mL vial

≥ 99%

Ala-Glu-Asp-Gly

Telomerase & longevity research

$55.00 / 5mL vial

≥ 99%

C₁₈H₂₄O₃ · ½H₂O

Estrogen-receptor & hormone-signaling research

Coming Soon

Extracellular vesicles (30–150 nm)

Intercellular signaling & regenerative research

Call for Prices
888-857-9119

≥ 99%

AOD9604 + MOTS-C + Lipotropic MIC + Tesamorelin + NAD+ blend

Lipolytic & metabolic fat-burning blend research

Coming Soon

≥ 99%

D-Leu-D-Pro-D-Ala-D-Ala-D-Asp-D-Ala (FOXO4-DRI)

Senolytic & senescent-cell clearance research

Coming Soon

≥ 99%

Gly-His-Lys-Cu (copper complex)

Tissue repair, anti-aging & wound-healing research

$29.00 / 2mL vial

≥ 99%

BPC-157 10mg + TB-500 10mg + GHK-Cu 50mg blend

Cosmetic skin-renewal & collagen-support research

$80.00 / 2mL vial

≥ 99%

Semaglutide 0.25mg + Tirzepatide 2.5mg blend

Dual GLP-1 / GIP-GIP-1 receptor agonism research

$50.00 / 2mL vial

≥ 99%

γ-Glu-Cys-Gly (reduced)

Master antioxidant & detoxification research

$37.00 / 10mL vial

≥ 99%

His-D-2MeTrp-Ala-Trp-D-Phe-Lys-NH₂

Growth hormone secretagogue research

Coming Soon

≥ 99%

C₆H₁₂O₆ (myo-Inositol)

Insulin-sensitivity & neurotransmitter-signaling research

$14.00 / 2mL vial

≥ 99%

Aib-His-D-2-Nal-D-Phe-Lys-NH₂

Selective GH secretagogue research

$47.00 / 2mL vial

≥ 99%

TNLNLKGLFG-NH₂

GnRH regulation & reproductive research

$37.00 / 2mL vial

≥ 99%

BPC-157 10mg + TB-500 10mg + GHK-Cu 50mg + KPV 10mg blend

Cosmetic skin-renewal & collagen-support research

$95.00 / 2mL vial

≥ 99%

Lys-Pro-Val

Anti-inflammatory & gut-immune research

$40.00 / 2mL vial

≥ 99%

C₇H₁₅NO₃

Fatty-acid transport & energy-metabolism research

Coming Soon

≥ 99%

C₅H₁₁NO₂S + C₆H₁₂O₆ + C₅H₁₄NO

Lipotropic fat-metabolism & liver-support research

$12.00 / 10mL vial

≥ 99%

C₅H₁₁NO₂S + C₆H₁₂O₆ + C₅H₁₄NO + C₆₃H₈₈CoN₁₄O₁₄P

Lipotropic + B12 energy-metabolism research

$14.00 / 10mL vial

≥ 99%

C₅H₁₁NO₂S (L-Methionine)

Methylation & lipotropic-metabolism research

$14.00 / 2mL vial

≥ 99%

Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH₂

Melanocortin-1 receptor & tanning research

$45.00 / 2mL vial

≥ 99%

Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂

Melanocortin receptor research

Coming Soon

≥ 99%

C₆₃H₉₁CoN₁₃O₁₄P (Methylcobalamin)

Energy-metabolism & erythropoiesis research

Coming Soon

≥ 99%

C₁₆H₁₈ClN₃S (small molecule)

Mitochondrial & redox-cycling research

$99.00 / 10mL vial

≥ 99%

Met-Arg-Trp-Gln-Glu-Met-Pro-Val-Phe-Leu-Ser-Pro

Mitochondrial-derived metabolic & exercise research

$60.00 / 2mL vial

≥ 99%

Nicotinamide adenine dinucleotide

Cellular metabolism & sirtuin research

$70.00 / 10mL vial

≥ 99%

CYIQNCPLG-NH₂ (disulfide bridge 1-6)

Neuropeptide & social-bonding research

$52.00 / 2mL vial

≥ 99%

Ac-NLc[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂

Melanocortin & sexual-health research

$29.00 / 2mL vial

≥ 99%

Thr-Lys-Pro-Arg-Pro-Gly-Pro

Anxiolytic & cognitive-support research

$41.00 / 2mL vial

≥ 99%

HAib-GTFTSDVSSYLEGQAAKEFIAWLVRGRG

GLP-1 receptor agonism

$70.00 / 2mL vial

≥ 99%

Met-Glu-His-Phe-Pro-Gly-Pro

Cognitive-enhancement & neuroprotective research

$47.00 / 2mL vial

≥ 99%

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Ala-Asp-Leu

GHRH analog & growth-hormone-release research

$60.00 / 2mL vial

≥ 99%

Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala (Acetyl Octapeptide-3)

Neuromodulatory & cosmetic anti-aging research

Coming Soon

≥ 99%

Synthetic tripeptide (Waglerin-1 analog)

Neuromuscular & cosmetic anti-wrinkle research

Coming Soon

Multipotent / stem-cell populations

Regenerative & differentiation research

Coming Soon

≥ 99%

LKKTETQE

Actin-binding & recovery research

$40.00 / 2mL vial

≥ 99%

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu

HIV-associated lipodystrophy & GHRH research

$66.00 / 2mL vial

≥ 99%

Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn

Immune-modulation & T-cell research

$79.00 / 2mL vial

≥ 99%

YAib-GTFTSDYQKSVSELLGQAAKEFIAWLVRQG

Dual GIP/GLP-1 agonism

$125.00 / 2mL vial

≥ 99%

Aib-GTFTSDYSKSVLNGQAAKEFIAWLVRGRGNH₂

Triple GIP/GLP-1/Glucagon receptor agonism

$80.00 / 2mL vial

≥ 99%

His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Lys-NH₂

Vasodilatory & neuroimmune-signaling research

Coming Soon

≥ 99%

L-Ascorbic acid (C₆H₈O₆)

Antioxidant & collagen-synthesis research

Coming Soon

≥ 99%

Cholecalciferol (C₂₇H₄₄O)

Calcium homeostasis & immune-support research

Coming Soon

≥ 99%

BPC-157 + TB-500 blend

Tissue repair & recovery blend research

$89.00 / 2mL vial

Pharma Peptide Sciences — Precision Peptides. Powering Results.

Research-grade peptide synthesis and analytical services for the global scientific community.

© 2026 Pharma Peptide Sciences. All rights reserved.

For research use only. Not for human consumption, diagnosis, or treatment.

Research Use Disclaimer: All products sold by Pharma Peptide Sciences are intended solely for laboratory research, analytical, and scientific investigation purposes. These products are not intended for human consumption, veterinary use, therapeutic use, or any form of clinical or diagnostic application. Purchasers must be 21 years of age or older to purchase products from this website. By accessing, purchasing from, or using this website, you acknowledge and agree that you are qualified to purchase research materials and will use all products in accordance with applicable federal, state, and local laws and regulations. You further agree that you are solely responsible for the safe handling, storage, use, and disposal of all products purchased from Pharma Peptide Sciences. Products sold by Pharma Peptide Sciences may present hazards if improperly handled. Customers are expected to possess the knowledge, training, and facilities necessary to safely work with laboratory research materials. Any misuse, misrepresentation, resale for unauthorized purposes, or use inconsistent with these terms is strictly prohibited.

FDA Disclaimer: The statements made on this website have not been evaluated by the United States Food and Drug Administration (FDA). The products offered by Pharma Peptide Sciences are not intended to diagnose, treat, cure, mitigate, or prevent any disease or medical condition. All products are sold exclusively for laboratory research, analytical, and scientific purposes and are not intended for human or animal consumption. Pharma Peptide Sciences is a supplier of research chemicals and laboratory materials, not a licensed pharmacy, compounding pharmacy or facility (Section 503A), outsourcing facility (Section 503B), or medical device or pharmaceutical manufacturer. By purchasing, you represent that you are at least 21 years of age, understand the products are for lawful research purposes only, and assume full responsibility and liability for their proper and lawful use. Pharma Peptide Sciences reserves the right to refuse or cancel any order if it believes the products may be used in violation of applicable laws or these Terms and Conditions.