Precision APIs for Scientific Breakthroughs
Advancing science through precision, purity and innovation.
- 99%+
- Purity (HPLC)
- 15+
- Years of expertise
- 100,100+
- Peptides delivered
- 30+
- Countries served
About us
An Industry Partner Built on Science and Trust
Trusted by 4000+ research teams worldwide
Pharma Precision Sciences delivers high purity, exosomes, custom and catalog vitamins, peptides and minerals backed by rigorous QC, fast turnaround, and decades of expertise. We are dedicated to producing the highest quality grade products of exceptional purity for ultimate research results. Our team of chemists and pharmacists have 30+ years of experience in sourcing and procuring only the highest grade products on the market.
We perform top level testing to assure the product being utilized by our customers is exactly what the customer is purchasing at the purity levels listed. Any product that does not pass our stringent quality assurance testing requirements, which includes GCMS and HPLC testing, will not be sold to our customers. Because of the rigorous, high level of testing our products endure, our products are best suited for pharmaceutical and biotech researchers worldwide.
We can tailor every project to your sequence, modifications, and timeline—delivering material you can build your research on.
From sourcing through quality review and fulfillment, our focus is on reliability, transparency, and scientific integrity.
Purity Guaranteed
All CoAs are available and posted on this site under Supply Chain, with HPLC and mass-spec data confirming purity ≥ 99%. Please contact us regarding any questions or if you would like a specific CoA for your products. Custom orders will be sent with all appropriate CoAs. Bulk orders of 25 or more vials will be sent with CoAs.
Global Delivery
Temperature-controlled logistics to research labs and pharmaceutical research companies across 30+ countries.
Precision Built for Research
At Pharma Precision Sciences, we are committed to supplying researchers with product materials supported by rigorous quality standards and dependable service. Every product we offer is selected to help laboratories achieve consistent, reproducible research outcomes.
Quality You Can Trust
Research begins with dependable materials. That's why every product we offer is accompanied by comprehensive quality documentation and is handled using established quality procedures designed to maintain product integrity throughout storage and shipment. Our commitment is to provide researchers with confidence in every order.
Supporting Scientific Discovery
Scientific advancement depends on reliable research materials. Pharma Precision Sciences partners with research professionals by providing products backed by responsive customer service, quality documentation, and a commitment to consistency.
Whether supporting academic, pharmaceutical, or biotechnology research, we strive to be a trusted resource for the scientific community.
Our Commitment
At Pharma Precision Sciences, quality is more than a standard—it's the foundation of everything we do. We continually evaluate our processes, documentation, and supplier relationships to help ensure the research materials we provide meet the expectations of today's laboratories.
Our goal is to build lasting relationships through professionalism, integrity, and dependable service.
What we do
End-To-End Services
From first design to final QC, we provide everything you need to move your research forward.
Custom Product Synthesis
Standard and complex sequences from 2 to 60+ residues, synthesized to your exact specification.
Modified Products
Phosphorylation, methylation, fluorescent labels, cyclic and stapled constructs.
Catalog Peptides
A ready-to-ship library of high-purity research peptides for immediate needs.
Analytical & QC Testing
HPLC, LC-MS, and amino-acid analysis with a full Certificate of Analysis.
Scale-Up Production
Seamless transition from milligram discovery scale to multi-gram supply.
Consultation & Design
Expert support on sequence design, solubility, and modification strategy.
Catalog
Featured Research Products
In-stock peptides ship within 24–48 hours if ordered by 16:00 EST — Monday–Thursday for cold-storage items, Monday–Friday for all others. Add to cart and check out securely.
Tirzepatide 25mg + Retatrutide 20mg blend
Triple GIP/GLP-1/Glucagon receptor agonism blend research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$140.00 / 2mL vial
C₁₀H₁₆N₂O₃S (Vitamin B7)
Metabolic & enzyme-cofactor research
Coming Soon
GEPPPGKPADDAGLV
Gastrointestinal & healing studies
Pharmaceutical Injectable Purity
$39.00 / 2mL vial
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Leu-Leu-Ala-Gln-Lys-(DAC)
Extended half-life GH-releasing research
Pharmaceutical Injectable Purity
$78.00 / 2mL vial
C₅H₁₄NO (Choline)
Lipotropic & neurotransmitter-precursor research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$14.00 / 2mL vial
C₆₃H₈₈CoN₁₄O₁₄P (Cyanocobalamin)
Energy-metabolism & erythropoiesis research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$20.00 / 10mL vial
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Leu-Leu-Ala-Gln-Lys
Short-acting GH secretagogue research
Pharmaceutical Injectable Purity
$46.00 / 2mL vial
CJC-1295 w/o DAC 9mg + Ipamorelin 15mg blend
Dual GH-secretagogue blend research
Pharmaceutical Injectable Purity
$49.00 / 6mL vial
Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
Sleep-regulation & neuroendocrine research
Pharmaceutical Injectable Purity
$55.00 / 2mL vial
Ala-Glu-Asp-Gly
Telomerase & longevity research
Pharmaceutical Injectable Purity
$55.00 / 5mL vial
C₁₈H₂₄O₃ · ½H₂O
Estrogen-receptor & hormone-signaling research
Coming Soon
Extracellular vesicles (30–150 nm)
Intercellular signaling & regenerative research
Call for Prices
888-857-9119
AOD9604 + MOTS-C + Lipotropic MIC + Tesamorelin + NAD+ blend
Lipolytic & metabolic fat-burning blend research
Coming Soon
D-Leu-D-Pro-D-Ala-D-Ala-D-Asp-D-Ala (FOXO4-DRI)
Senolytic & senescent-cell clearance research
Coming Soon
Gly-His-Lys-Cu (copper complex)
Tissue repair, anti-aging & wound-healing research
Pharmaceutical Injectable Purity
$29.00 / 2mL vial
BPC-157 10mg + TB-500 10mg + GHK-Cu 50mg blend
Cosmetic skin-renewal & collagen-support research
Pharmaceutical Injectable Purity
$80.00 / 2mL vial
Semaglutide 0.25mg + Tirzepatide 2.5mg blend
Dual GLP-1 / GIP-GIP-1 receptor agonism research
Pharmaceutical Injectable Purity
$50.00 / 2mL vial
γ-Glu-Cys-Gly (reduced)
Master antioxidant & detoxification research
Pharmaceutical Injectable Purity
$37.00 / 10mL vial
His-D-2MeTrp-Ala-Trp-D-Phe-Lys-NH₂
Growth hormone secretagogue research
Coming Soon
C₆H₁₂O₆ (myo-Inositol)
Insulin-sensitivity & neurotransmitter-signaling research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$14.00 / 2mL vial
Aib-His-D-2-Nal-D-Phe-Lys-NH₂
Selective GH secretagogue research
Pharmaceutical Injectable Purity
$47.00 / 2mL vial
TNLNLKGLFG-NH₂
GnRH regulation & reproductive research
Pharmaceutical Injectable Purity
$37.00 / 2mL vial
BPC-157 10mg + TB-500 10mg + GHK-Cu 50mg + KPV 10mg blend
Cosmetic skin-renewal & collagen-support research
Pharmaceutical Injectable Purity
$95.00 / 2mL vial
Lys-Pro-Val
Anti-inflammatory & gut-immune research
Pharmaceutical Injectable Purity
$40.00 / 2mL vial
C₇H₁₅NO₃
Fatty-acid transport & energy-metabolism research
Coming Soon
C₅H₁₁NO₂S + C₆H₁₂O₆ + C₅H₁₄NO
Lipotropic fat-metabolism & liver-support research
Pharmaceutical Injectable Purity
$12.00 / 10mL vial
C₅H₁₁NO₂S + C₆H₁₂O₆ + C₅H₁₄NO + C₆₃H₈₈CoN₁₄O₁₄P
Lipotropic + B12 energy-metabolism research
Pharmaceutical Injectable Purity
$14.00 / 10mL vial
C₅H₁₁NO₂S (L-Methionine)
Methylation & lipotropic-metabolism research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$14.00 / 2mL vial
Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH₂
Melanocortin-1 receptor & tanning research
Pharmaceutical Injectable Purity
$45.00 / 2mL vial
Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
Melanocortin receptor research
Coming Soon
C₆₃H₉₁CoN₁₃O₁₄P (Methylcobalamin)
Energy-metabolism & erythropoiesis research
Coming Soon
C₁₆H₁₈ClN₃S (small molecule)
Mitochondrial & redox-cycling research
Pharmaceutical Injectable Purity
Food Grade Available upon request
$99.00 / 10mL vial
Met-Arg-Trp-Gln-Glu-Met-Pro-Val-Phe-Leu-Ser-Pro
Mitochondrial-derived metabolic & exercise research
Pharmaceutical Injectable Purity
$60.00 / 2mL vial
Nicotinamide adenine dinucleotide
Cellular metabolism & sirtuin research
Pharmaceutical Injectable Purity
$70.00 / 10mL vial
CYIQNCPLG-NH₂ (disulfide bridge 1-6)
Neuropeptide & social-bonding research
Pharmaceutical Injectable Purity
$52.00 / 2mL vial
Ac-NLc[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
Melanocortin & sexual-health research
Pharmaceutical Injectable Purity
$29.00 / 2mL vial
Thr-Lys-Pro-Arg-Pro-Gly-Pro
Anxiolytic & cognitive-support research
Pharmaceutical Injectable Purity
$41.00 / 2mL vial
HAib-GTFTSDVSSYLEGQAAKEFIAWLVRGRG
GLP-1 receptor agonism
Pharmaceutical Injectable Purity
Food Grade Available upon request
$70.00 / 2mL vial
Met-Glu-His-Phe-Pro-Gly-Pro
Cognitive-enhancement & neuroprotective research
Pharmaceutical Injectable Purity
$47.00 / 2mL vial
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Ala-Asp-Leu
GHRH analog & growth-hormone-release research
Pharmaceutical Injectable Purity
$60.00 / 2mL vial
Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala (Acetyl Octapeptide-3)
Neuromodulatory & cosmetic anti-aging research
Coming Soon
Synthetic tripeptide (Waglerin-1 analog)
Neuromuscular & cosmetic anti-wrinkle research
Coming Soon
LKKTETQE
Actin-binding & recovery research
Pharmaceutical Injectable Purity
$40.00 / 2mL vial
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu
HIV-associated lipodystrophy & GHRH research
Pharmaceutical Injectable Purity
$66.00 / 2mL vial
Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn
Immune-modulation & T-cell research
Pharmaceutical Injectable Purity
$79.00 / 2mL vial
YAib-GTFTSDYQKSVSELLGQAAKEFIAWLVRQG
Dual GIP/GLP-1 agonism
Pharmaceutical Injectable Purity
Food Grade Available upon request
$125.00 / 2mL vial
Aib-GTFTSDYSKSVLNGQAAKEFIAWLVRGRGNH₂
Triple GIP/GLP-1/Glucagon receptor agonism
Pharmaceutical Injectable Purity
Food Grade Available upon request
$80.00 / 2mL vial
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Lys-NH₂
Vasodilatory & neuroimmune-signaling research
Coming Soon
L-Ascorbic acid (C₆H₈O₆)
Antioxidant & collagen-synthesis research
Coming Soon
Cholecalciferol (C₂₇H₄₄O)
Calcium homeostasis & immune-support research
Coming Soon
BPC-157 + TB-500 blend
Tissue repair & recovery blend research
Pharmaceutical Injectable Purity
$89.00 / 2mL vial
Make Your Own Peptide Blend
Custom sequences and multi-peptide blends built to your specification. Minimum order of 25 vials. Tell us what you need and we'll provide a tailored quote.
You can request items that are not in our list above and we will work up a quote for you — example Tirzepatide, MOTS-C, Tesamorelin, L-Carnitine, VIP, etc. in a vial (please indicate vial size) and how many mg per each drug. We will provide you a quote in 24–48 hours.
Special Request
If you would like a certain amount of peptide in a certain vial size, please request it here. Sample information: Tirzepatide 100mg in a 50mL vial, or NAD+ 5000mg in a 100mL vial, etc.
You can request items that are not in our list above and we will work up a quote for you. Please allow us 24–48 hours to respond with pricing.
Bacteriostatic Water
Sterile bacteriostatic water (0.9% benzyl alcohol) for reconstitution of research peptides. Select your vial size and add to cart.
$10.00
Research categories
Beyond peptides
In addition to our peptide catalog, Pharma Precision Sciences supports research across complementary product categories. The information below is provided for educational and research-context purposes only.
Exosomes
Exosomes are nanometer-scale (30–150 nm) extracellular vesicles secreted by cells, carrying proteins, lipids, and regulatory nucleic acids such as mRNA and miRNA. They are studied as intercellular messengers in regenerative medicine, wound-healing, immune-modulation, and drug-delivery research, and are an active area of biomarker-discovery and anti-aging investigation.
Vitamins
Vitamins are essential organic compounds required in small amounts for normal cellular function. Our catalog includes research-grade vitamins such as Vitamin C (L-ascorbic acid), Vitamin D3 (cholecalciferol), Biotin (B7), and B12 forms (cyanocobalamin and methylcobalamin), studied for antioxidant, immune, metabolic, methylation, and energy-metabolism research applications.
Minerals
Minerals are inorganic elements that serve as enzyme cofactors, structural components, and electrolytes in biological systems. Common research minerals include zinc, magnesium, selenium, and copper, which are studied for immune function, enzymatic catalysis, oxidative-stress balance, and metabolic-pathway research. Mineral products are coming soon to our catalog.
Nasal Sprays
Coming SoonNasal spray formulations deliver active compounds across the nasal mucosa for research into mucosal absorption, CNS-targeting pathways, and intranasal pharmacokinetics. Our research-grade nasal spray line is in development and will be available soon.
All products are intended strictly for legitimate laboratory research, analytical, and scientific purposes only.
Quality & process
Purity you can verify
Every peptide we produce passes a documented four-stage process before it reaches your bench. No shortcuts, no compromises—just material built on traceable quality.
- 01
Design & Synthesis
Sequence review and solid-phase synthesis on state-of-the-art instruments.
- 02
Purification
Reverse-phase HPLC purification to isolate the target peptide.
- 03
QC Verification
Purity confirmed by analytical HPLC and identity by mass spectrometry.
- 04
Delivery
Lyophilized and shipped under temperature-controlled conditions; a CoA is available upon request.
Certificate of Analysis
A full CoA is available for every lot — on request
Each lot is independently tested before it leaves our facility. A Certificate of Analysis documenting the exact purity and identity of your peptide is available upon request — simply provide the lot number and we'll send the full certificate.
HPLC Purity
≥ 99%High-performance liquid chromatography confirms chemical purity and detects residual impurities, solvents, and by-products.
Mass Spectrometry
MW ConfirmedESI-MS verifies the molecular weight of the synthesized peptide matches the theoretical mass.
Amino Acid Analysis
AAAConfirms the amino acid composition and net peptide content of the final product.
Residual Solvents
USP <467>Headspace GC screens for residual manufacturing solvents against pharmacopeial limits.
Peptide Content
Net WeightGravimetric determination of the actual peptide mass, excluding counterions and water.
Endotoxin
LAL TestedLimulus amebocyte lysate assay confirms bacterial endotoxin levels are within specification.
Lot-traceable documentation
Every CoA is tied to a specific lot number printed on the vial label, so results are verifiable and reproducible — not generic stock reports.
Third-party verification
We periodically send random lots to independent analytical labs for confirmatory testing, and publish those results on request.
Need a CoA for a specific lot?
Send us the lot number and we'll provide the full certificate within one business day.
Storage Guidelines
Proper storage preserves potency
Correct handling and storage are essential to maintain the integrity of research materials. Follow these guidelines to keep peptides, exosomes, vitamins, and minerals stable from receipt to use.
Lyophilized Peptides
Store as a dry powder for maximum stability.
- Long-term: −20 °C (freezer), desiccated and protected from light.
- Short-term (< 4 weeks): 2–8 °C (refrigerator) is acceptable.
- Keep the vial sealed until ready for use — moisture triggers degradation.
Reconstituted Peptides
Once mixed with bacteriostatic water, shelf life drops sharply.
- Refrigerate at 2–8 °C immediately after reconstitution.
- Use within the recommended window for the specific peptide (typically 30–60 days).
- Avoid repeated freeze-thaw cycles; aliquot into separate vials if needed.
Exosomes
Highly temperature-sensitive biological material.
- Store at −80 °C for long-term preservation of vesicle integrity.
- Thaw once on ice and use; do not refreeze thawed aliquots.
- Minimize agitation and exposure to room temperature.
Vitamins & Supplements
Keep dry, cool, and away from direct sunlight.
- Store at room temperature (15–25 °C) in the original container.
- Protect from humidity — do not store in bathrooms or near sinks.
- Keep tightly sealed; discard if discoloration or clumping occurs.
Minerals
Stable when kept dry and sealed.
- Store at room temperature (15–25 °C) away from moisture.
- Keep containers closed to prevent oxidation and caking.
- Avoid mixing with acidic or reactive substances during handling.
General handling principles
Maintain consistent temperature — fluctuations degrade active compounds.
Use insulated, cold-chain shipping for frozen and refrigerated items.
Always label vials with the date of receipt and reconstitution.
Why choose us
Why Choose Pharma Precision Sciences?
Our mission
Built on Scientific Integrity
At Pharma Precision Sciences, we believe reliable research starts with reliable materials. Our mission is to provide the scientific community with peptide products that meet high standards for quality, consistency, and documentation.
By combining careful supplier qualification, quality-focused processes, and exceptional customer service, we help researchers spend less time worrying about their materials and more time advancing scientific discovery.
Get notified when new peptides arrive
Join our list for updates on new stock, restocks, and special pricing. No spam — just product availability.
Get in touch
Request a quote
Tell us about your peptide or sequence and we'll respond within one business day with a quote and timeline.